PTM Viewer

For each protein all PTMs are highlighted by default in the respective protein sequence (right-hand side). One can adjust a selection of PTMs in the PTM table on the left-hand side. In addition, functional protein domains and sites can be underlined if desired.

In the PTM table per PTM the PTM position and type is indicated, as well as the plain peptide sequence that was identified by mass spectrometry. The respective proteomics study is indicated by a number, providing a link to consult the experimental details. Additional PTM meta-data includes various confidence measures such as peptide score provided by search algorithms, posterior error probability (PEP), precursor mass deviation (in ppm) and modification site probability. The available confidence meta-data can be consulted in the extended PTM table by clicking SHOW CONFIDENCE. However, in the default PTM table, a color-coding of confidence is provided with green indicating high confidence, olive medium confidence, grey low confidence, and no color an unassigned confidence. More details regarding this confidence assignment can be consulted in the tutorial or the Plant PTM Viewer manuscript.

Besides confidence measures, log2 fold changes between two conditions with significance values (P- or Q-values) are shown if provided in the respective publication. Log2 fold changes are colored in heatmap-like gradient (green = induced, red = repressed) and significant values are highlighted in green. To determine significance, we employed the threshold used in the respective publication. For more details on the quantitative measurements we refer to the experimental details and respective publication, as methodologies can differ.

On the bottom of the page one can send the whole protein or a part of the protein (i.e. a functional domain) to PTM Blast. This will display aligned protein sequences that potentially report aligned PTMs.

PTMs

Export
Results

PTM Type	Mod AA	Pos	Peptide	Exp ID	Log2 FC	P/Q val	Score Type	Ident Score	Loc Prob	PEP	Mass Error (ppm)
nt	A	2	ANSSAGSAADHR	89b			XCorr	2.884
nt	A	2	ANSSAGSAADHR	89c			XCorr	2.801
nta	A	2	ANSSAGSAADHRNKHL	167a
			ANSSAGSAADHR	80			MASCOT Score	68.180		2.943e-5
				89b			XCorr	2.884
				89c			XCorr	2.801
ph	S	4	ANSSAGSAADHR	88			MASCOT Score	70.000	1.000		-0.420
ph	S	4	ANSSAGSAADHR	114			MaxQuant score	126.710	0.977	1.012e-5
fuc	S	5	MANSSAGSAADHR	162						-4.700e-1
ph	S	5	ANSSAGSAADHR	88			MASCOT Score	35.000	0.923		0.450
ph	S	5	ANSSAGSAADHR	114			MaxQuant score	103.130	0.978	2.975e-5
ph	S	18	HLSVNPPHQIFK	114			MaxQuant score	153.090	1.000	1.539e-7
ph	S	39	DIQGSDNAIPLSPQWLLSKPGENK	18a			MaxQuant Score	61.538	0.996	1.225e-5	0.208
				35
				38			MASCOT Score	83.940			-0.814
				48			MASCOT Score	33.830
				60			MASCOT Score	109.460			-1.037
				83			MASCOT Score	56.000			-0.002
				85			XCorr	3.000	0.996	2.529e-5
				94			MaxQuant Score	94.632	0.991	3.864e-4	2.054
				97
				109					1.000
				111a	1.083	0.022		29.470			0.932
				111b	1.083	0.022		29.470			0.932
				111c	0.306	0.177		29.470			0.932
				111d	0.306	0.177		29.470			0.932
				114			MaxQuant score	207.690	1.000	0.000e+0
ph	S	45	DIQGSDNAIPLSPQWLLSKPGENK	83			MASCOT Score	39.000			-0.001
ph	Y	62	TGMGTGDPNQYGNHSDVVR	63			MASCOT Score	22.000			-0.472
ph	S	66	TGMGTGDPNQYGNHSDVVR	114			MaxQuant score	113.490	1.000	2.596e-10
ph	T	78	TTGNGEETLDNLK	114			MaxQuant score	125.830	1.000	1.805e-4
ph	S	91	DVFRPSLLDAESGRR	114			MaxQuant score	96.550	1.000	1.019e-5
ph	S	97	DVFRPSLLDAESGRR	114			MaxQuant score	118.460	1.000	1.196e-6
ph	S	113	DTLSSVRNDR	114			MaxQuant score	87.641	0.988	3.018e-3
ph	S	156	WTDSGNKDAAPEQR	114			MaxQuant score	124.300	0.998	6.978e-5
ub	K	202	EKGPSLPTSDGDHYR	40			MaxQuant Score	50.305	1.000	4.062e-5	1.270
ph	S	241	QVTSFSHSR	114			MaxQuant score	65.241	0.950	5.871e-3
ph	S	243	QVTSFSHSR	114			MaxQuant score	106.290	0.871	6.561e-4
ph	S	245	QVTSFSHSR	114			MaxQuant score	65.179	0.831	1.611e-2
me2	R	248	GRGENTAIFSAGRGR	123			MaxQuant Score	53.300	1.000	3.031e-3	0.347
me2	R	259	GRGENTAIFSAGRGR	123			MaxQuant Score	53.300	1.000	3.031e-3	0.347
ph	S	263	MSPGGSIFTSAPNQSHPPGSASDKGESGPGEPPHLR	114			MaxQuant score	222.420	1.000	0.000e+0
ph	S	263	MSPGGSIFTSAPNQSHPPGSASDK	100			XCorr	3.664	0.847	9.656e-3
ph	S	267	MSPGGSIFTSAPNQSHPPGSASDKGESGPGEPPHLR	114			MaxQuant score	84.954	0.973	3.429e-21
ub	K	302	MKLLDVYR	40			MaxQuant Score	66.692	1.000	1.000e-2	-0.317
ph	S	380	NPVEFSQPRR	114			MaxQuant score	141.710	1.000	8.159e-5
ph	S	390	IRPAGSREDMTFGAEESKDESGETR	18a			MaxQuant Score	49.525	0.751	4.389e-4	-0.181
				38			MASCOT Score	54.000
				44			XCorr	3.668
				48			MASCOT Score	69.090
				83			MASCOT Score	40.000			0.001
				88			MASCOT Score	31.000	0.865		-0.040
				100			XCorr	5.233	1.000	1.037e-6
			PAGSREDMTFGAEESKDESGETR	88			MASCOT Score	42.000	1.000		-0.070
			RIRPAGSREDMTFGAEESK	100			XCorr	3.426	1.000	1.045e-4
			IRPAGSREDMTFGAEESK	83			MASCOT Score	25.000			0.002
				88			MASCOT Score	29.000	0.991		0.480
				100			XCorr	3.020	0.998	2.320e-2
				109					1.000
				114			MaxQuant score	134.680	1.000	4.731e-15
ph	S	401	IRPAGSREDMTFGAEESKDESGETR	48			MASCOT Score	35.940
ub	K	402	EDMTFGAEESKDESGETR	40			MaxQuant Score	112.820	1.000	1.099e-31	-0.343
ph	S	421	FRPEASHEGYAPFR	114			MaxQuant score	83.253	1.000	9.153e-5
ph	S	452	ELKEPSMQGNAHVQSASPWR	114			MaxQuant score	146.150	0.918	1.363e-24
ph	S	454	ELKEPSMQGNAHVQSASPWR	114			MaxQuant score	181.770	0.912	5.745e-44
ph	S	465	SNRNSHDWNDPSADSR	114			MaxQuant score	139.040	1.000	1.469e-8
ph	S	469	SNRNSHDWNDPSADSR	88			MASCOT Score	27.000	1.000		-0.150
				100			XCorr	3.519	0.913	1.574e-5
				109					0.946
				114			MaxQuant score	139.040	1.000	1.469e-8
fuc	S	479	SNRNSHDWNDPSADSRLK	162						5.100e-1
ph	S	486	SSDSVWSHPK	114			MaxQuant score	163.590	1.000	4.175e-7
og	S	508	SSDSVWSHPKDSINHLGGNNMMLPQSK	81			MASCOT Score	21.800			0.015
			DSINHLGGNNMMLPQSKGESR	81			MASCOT Score	33.000			1.600
			DSINHLGGNNMMLPQSK	81			MASCOT Score	53.800			-1.200
ph	S	508	DSINHLGGNNMMLPQSKGESR	114			MaxQuant score	49.095	0.936	4.773e-4
ph	S	521	WQISEDPSLR	114			MaxQuant score	154.940	1.000	9.298e-7
ph	S	527	RQPSLVFDREQEVR	18a			MaxQuant Score	111.340	1.000	5.419e-12	0.142
				46			MASCOT Score	50.750			-16.451
				48			MASCOT Score	32.640
				83			MASCOT Score	44.000			-0.000
				85			XCorr	2.627	1.000	1.506e-2
				100			XCorr	2.143	1.000	1.706e-2
				109					1.000
				114			MaxQuant score	174.050	1.000	2.767e-6
			RQPSLVFDR	28
				60			MASCOT Score	37.880			-0.271
				83			MASCOT Score	26.000			0.000
				84b			XCorr	2.900	1.000	1.664e-1
				85			XCorr	2.859	1.000	2.732e-3
				88			MASCOT Score	58.000	1.000		-0.590
				100			XCorr	2.669	1.000	9.112e-4
			QPSLVFDR	88			MASCOT Score	29.000	1.000		-0.460
ph	S	543	LLPSSPEELSLYYK	114			MaxQuant score	150.110	0.998	2.658e-7
ac	K	606	AKSGPPPGFTGAK	101
ph	S	638	VHSGMGETDMLQNDMR	114			MaxQuant score	77.899	0.884	9.334e-5
nt	Y	652	YKHVAGTVAENR	167b
og	T	658	YKHVAGTVAENR	81			MASCOT Score	58.100			1.600
og	T	658	HVAGTVAENR	81			MASCOT Score	27.400			4.300
ph	S	716	QRSIPSPYSYWPGR	83			MASCOT Score	22.000			-0.000
			QRSIPSPYSYWPGR	114			MaxQuant score	176.980	1.000	2.026e-16
			SIPSPYSYWPGR	38			MASCOT Score	63.550			-0.644
				60			MASCOT Score	50.470			-4.011
				83			MASCOT Score	43.000			0.000
				109					0.999
ph	S	719	QRSIPSPYSYWPGR	83			MASCOT Score	30.000			0.000
			QRSIPSPYSYWPGR	100			XCorr	4.626	0.885	8.953e-5
			SIPSPYSYWPGR	114			MaxQuant score	105.650	0.999	8.892e-5
ph	S	749	SPSSDLLSILQGVTDR	44			XCorr	4.071
ph	S	749	SPSSDLLSILQGVTDR	66			MaxQuant Score	110.770			-0.141
ph	S	751	SPSSDLLSILQGVTDR	61a			MASCOT Score	41.000	1.000
				66			MaxQuant Score	137.130			0.948
				85			XCorr	3.910	0.978	3.356e-13
				106	-0.286	0.158	MASCOT Score	56.000
				111a	-1.056	0.000		98.030			2.646
				111b	-1.056	0.000		98.030			2.646
				111c	-1.432	0.000		98.030			2.646
				111d	-1.432	0.000		98.030			2.646
				114			MaxQuant score	397.840	1.000	0.000e+0
ph	S	752	SPSSDLLSILQGVTDR	111a	0.570	0.000		96.290			0.530
				111b	0.570	0.000		96.290			0.530
				111c	-0.502	0.000		96.290			0.530
				111d	-0.502	0.000		96.290			0.530
og	S	770	SSPAVSGPLPAWSQPIQKESDLHHAK	81			MASCOT Score	43.900			0.330
og	S	770	SSPAVSGPLPAWSQPIQK	81			MASCOT Score	51.000			-0.830
og	S	777	SSPAVSGPLPAWSQPIQKESDLHHAK	81			MASCOT Score	43.500			0.760
og	S	777	SSPAVSGPLPAWSQPIQK	81			MASCOT Score	37.400			1.200
og	T	791	ESDLHHAKTFQTQIPFGVQQQR	81			MASCOT Score	50.700			0.340
og	S	932	LQPSKDMSQVNQQVQVPVSHEER	81			MASCOT Score	55.900			0.400
og	S	947	LQPSKDMSQVNQQVQVPVSHEER	81			MASCOT Score	55.900			0.400
og	S	947	DMSQVNQQVQVPVSHEER	81			MASCOT Score	20.700			1.100
ph	T	1087	GEVSIELSGETPATEVK	114			MaxQuant score	281.090	0.999	0.000e+0
ub	K	1102	KTSEKKSR	40			MaxQuant Score	86.898	1.000	4.000e-3	0.100
ub	K	1114	AKQAADLAKSTSR	40			MaxQuant Score	114.700	1.000	2.014e-14	0.523
ub	K	1121	AKQAADLAKSTSR	40			MaxQuant Score	106.140	1.000	9.177e-10	0.836
ph	S	1124	STSRAPLQETK	88			MASCOT Score	30.000	0.920		-0.500
ph	S	1124	STSRAPLQETK	114			MaxQuant score	153.140	0.998	8.620e-9
ph	S	1138	KPQPGSADDSEIKGK	85			XCorr	3.080	1.000	4.565e-5
			KPQPGSADDSEIKGK	114			MaxQuant score	171.150	1.000	3.063e-18
			KPQPGSADDSEIK	85			XCorr	3.163	1.000	4.354e-2
				88			MASCOT Score	75.000	1.000		3.480
				100			XCorr	4.383	1.000	1.044e-3
ph	S	1151	KSADTLIDNDTHLIK	109					0.790
			SADTLIDNDTHLIK	59			MASCOT Score	38.000			-0.734
				85			XCorr	2.681	0.989	3.444e-4
				88			MASCOT Score	63.000	1.000		0.430
				100			XCorr	4.203	0.999	2.530e-5
				114			MaxQuant score	318.950	1.000	0.000e+0
				136	-0.109	0.680	MASCOT score	61.970			6.710
ph	S	1182	SSTATASNTSQMSSEVDSVRGEESSLQNTR	114			MaxQuant score	118.160	0.832	1.041e-33
ph	S	1188	GEESSLQNTR	114			MaxQuant score	99.439	0.970	4.489e-4
ph	S	1211	SLLEIQMEEQR	114			MaxQuant score	106.260	1.000	4.151e-5
ph	S	1264	ETHGESAITQTGVVKPESVPTLK	114			MaxQuant score	96.544	0.969	1.090e-12
ph	S	1276	ETHGESAITQTGVVKPESVPTLK	114			MaxQuant score	154.820	0.997	7.150e-39
ph	S	1285	SHLHDLLADDVFAK	83			MASCOT Score	53.000			0.000
				84b			XCorr	2.530	1.000	9.055e-3
				100			XCorr	4.291	1.000	7.554e-7
				114			MaxQuant score	238.020	1.000	0.000e+0
ph	S	1365	IAAHVPAVDTSLQTNSVEK	114			MaxQuant score	84.375	0.870	8.148e-6
ph	T	1368	IAAHVPAVDTSLQTNSVEK	114			MaxQuant score	123.170	0.800	1.155e-14
ph	S	1370	IAAHVPAVDTSLQTNSVEK	44			XCorr	3.858
				100			XCorr	4.969	0.901	1.711e-5
				114			MaxQuant score	257.710	1.000	0.000e+0
ph	S	1407	GESVNNPPPAAAWSSGPK	114			MaxQuant score	88.283	1.000	7.019e-5
ph	S	1429	STKPSSLRDIVK	114			MaxQuant score	95.236	0.789	5.656e-5
ph	T	1442	MTTSSHPPPSPVPTTQK	114			MaxQuant score	113.820	0.793	4.200e-9
ph	S	1444	MTTSSHPPPSPVPTTQK	100			XCorr	3.096	0.886	2.442e-3
ph	S	1449	MTTSSHPPPSPVPTTQK	44			XCorr	3.450
				88			MASCOT Score	48.000	1.000		-1.440
				100			XCorr	2.971	0.995	1.314e-3
				109					0.998
				114			MaxQuant score	255.190	1.000	0.000e+0
ph	T	1453	MTTSSHPPPSPVPTTQK	114			MaxQuant score	113.820	0.813	4.200e-9
ph	S	1468	AIPPQAHQGGASWSR	114			MaxQuant score	108.450	0.962	1.620e-6
fuc	S	1470	AIPPQAHQGGASWSR	162						9.500e-1
og	S	1470	AIPPQAHQGGASWSR	81			MASCOT Score	45.300			-0.270
ph	S	1472	SASSPSQAVSQSSSQSK	44			XCorr	2.681
ph	S	1472	SASSPSQAVSQSSSQSK	100			XCorr	4.053	0.818	2.758e-7
fuc	S	1474	SASSPSQAVSQSSSQSK	162						-1.600e-1
ph	S	1474	SASSPSQAVSQSSSQSK	44			XCorr	2.699
				97
				106			MASCOT Score	45.000
				114			MaxQuant score	299.060	0.970	0.000e+0
ph	S	1475	SASSPSQAVSQSSSQSK	88			MASCOT Score	69.000	0.875		-0.200
ph	S	1475	SASSPSQAVSQSSSQSK	114			MaxQuant score	324.790	0.999	0.000e+0
ph	S	1477	SASSPSQAVSQSSSQSK	106	0.694	0.005	MASCOT Score	63.000
ph	S	1489	SKGDDDLFWGPVEQSTQDTK	114			MaxQuant score	68.153	1.000	5.980e-5
ph	S	1517	QGDFPHLTSQNSWGTK	61a			MASCOT Score	30.000	1.000
				83			MASCOT Score	23.000			-0.001
				100			XCorr	2.829	0.844	3.886e-2
ph	S	1520	QGDFPHLTSQNSWGTK	59			MASCOT Score	29.000			-0.850
				83			MASCOT Score	53.000			-0.001
				84b	2.188		XCorr	2.720	0.950	8.759e-4
				85			XCorr	2.261	0.968	5.456e-4
				88			MASCOT Score	39.000	0.922		-1.190
				109					0.998
				114			MaxQuant score	429.860	1.000	0.000e+0
ph	T	1526	NTPGKVNAGTSLNR	114			MaxQuant score	148.170	1.000	0.000e+0
fuc	T	1534	VNAGTSLNR	162						1.300e-1
ph	S	1535	VNAGTSLNR	114			MaxQuant score	135.800	0.974	1.008e-4
ph	S	1541	SVSMGSADRVLSSPVVTQASHK	94			MaxQuant Score	99.148	0.842	1.220e-4	1.896
			QKSVSMGSADR	88			MASCOT Score	41.000	0.938		-1.240
			QKSVSMGSADR	114			MaxQuant score	133.320	1.000	5.470e-6
			SVSMGSADR	88			MASCOT Score	50.000	1.000		0.150
				100			XCorr	2.805	0.990	1.283e-3
				109					0.958
ph	S	1543	QKSVSMGSADR	88			MASCOT Score	26.000	0.989		-0.050
ph	S	1543	SVSMGSADR	114			MaxQuant score	77.062	0.999	5.751e-3
ph	S	1546	SVSMGSADR	114			MaxQuant score	85.813	1.000	3.037e-3
ph	S	1552	VLSSPVVTQASHK	114			MaxQuant score	190.240	1.000	3.282e-30
ph	S	1553	VLSSPVVTQASHK	44			XCorr	3.310
				88			MASCOT Score	45.000	0.961		-1.320
				114			MaxQuant score	210.080	1.000	8.545e-33
ph	T	1557	VLSSPVVTQASHK	114			MaxQuant score	111.580	0.978	1.095e-4
ph	S	1560	VLSSPVVTQASHK	88			MASCOT Score	42.000	0.998		-0.780
ph	S	1560	VLSSPVVTQASHK	114			MaxQuant score	210.080	0.994	8.545e-33

Sequence

Length: 1714

MANSSAGSAADHRNKHLSVNPPHQIFKDIQGSDNAIPLSPQWLLSKPGENKTGMGTGDPNQYGNHSDVVRTTGNGEETLDNLKKKDVFRPSLLDAESGRRDRWRDEERDTLSSVRNDRWRNGDKDSGDNKKVDRWDNVAPKFGEQRRGPNDRWTDSGNKDAAPEQRRESKWNSRWGPDDKEAEIPRNKWDEPGKDGEIIREKGPSLPTSDGDHYRPWRPSQGRGRGEALHNQSTPNKQVTSFSHSRGRGENTAIFSAGRGRMSPGGSIFTSAPNQSHPPGSASDKGESGPGEPPHLRYSRMKLLDVYRMADTECYEKFPDGFIEVPSLTSEEPTDPLALCAPSSDEVNVLDAIEKGKIVSSGAPQTSKDGPTGRNPVEFSQPRRIRPAGSREDMTFGAEESKDESGETRNYPDDKFRPEASHEGYAPFRRGNEAPVRELKEPSMQGNAHVQSASPWRQSSGGERSNRNSHDWNDPSADSRLKSSDSVWSHPKDSINHLGGNNMMLPQSKGESRWQISEDPSLRRQPSLVFDREQEVRKLLPSSPEELSLYYKDPQGLIQGPFSGSDIIGWFEAGYFGIDLLVRLASAPNDSPFSLLGDVMPHLRAKSGPPPGFTGAKQNEFVDAAGTSAFPGVGKVHSGMGETDMLQNDMRYKHVAGTVAENRFIESLMSGGLTNSAQGVQGYGVNSSGGLSLPVTDGGADMYLLAKKLELERQRSIPSPYSYWPGRESANLMPGSENVSENAQQPTRSPSSDLLSILQGVTDRSSPAVSGPLPAWSQPIQKESDLHHAKTFQTQIPFGVQQQRLPEQNLPLSGLLGQPMENNPGGMLSPDMMLAAGLSQEHQSLNLLQQQQLLLQLNAQTPLSAQHQRLLVEKMLLLKHQHKQEEQQQLLRQQQQLYSQVFADQQRSQQRFGDPSYGQLQASLDALRLQPSKDMSQVNQQVQVPVSHEERGINLADLLPVTHATNQTVASFETPSLHLQNQLFGNVDPRMVLPDQIDDTHKKESKSEYERTVSADYVNSLYSEKPVLSPGYHATHNVEEPVSYPNNESSTATMTAPEIVESKLLEEQSKDMYAGKGEVSIELSGETPATEVKNNDVSVARKTSEKKSRKQRAKQAADLAKSTSRAPLQETKKPQPGSADDSEIKGKTKKSADTLIDNDTHLIKSSTATASNTSQMSSEVDSVRGEESSLQNTRTQPGRAWKPAPGFKPKSLLEIQMEEQRVAQAEALAPKISSTVNSVGSAAPWAGIVTNSDSNILRETHGESAITQTGVVKPESVPTLKAKKSHLHDLLADDVFAKSSDKEREVMEIISNNDAFMQVTTTNAESFDDDNFIDARETKKSRKKSARAKTSGAKIAAHVPAVDTSLQTNSVEKGKSSRILQQQEKEVLPAIPSGPSLGDFVLWKGESVNNPPPAAAWSSGPKKSTKPSSLRDIVKEQEKMTTSSHPPPSPVPTTQKAIPPQAHQGGASWSRSASSPSQAVSQSSSQSKSKGDDDLFWGPVEQSTQDTKQGDFPHLTSQNSWGTKNTPGKVNAGTSLNRQKSVSMGSADRVLSSPVVTQASHKGKKEAVTKLTEANGFRDWCKSECLRLLGSEDTSVLEFCLKLSRSEAETLLIENLGSRDPDHKFIDKFLNYKDLLPSEVVEIAFQSKGSGVGTRNNTGEDYYYNTTAANDGFSKVGGKKKAKKGKKVSLSASVLGFNVVSNRIMMGEIQTIED

ID	PTM Type	Color
nt	N-terminus Proteolysis	X
nta	N-terminal Acetylation	X
ph	Phosphorylation	X
fuc	O-Fucosylation	X
ub	Ubiquitination	X
me2	Dimethylation	X
og	O-GlcNAcylation	X
ac	Acetylation	X
	Multiple types	X

Domains & Sites

Clear highlighted range

**Interpro Domains**
Show	IPR ID	Description	From	To
	IPR003169	GYF domain	546	603

AT5G42950.1

Arabidopsis thaliana [ath]

GYF domain-containing protein

97 PTM sites : 8 PTM types

PLAZA: AT5G42950

Gene Family: HOM05D003992

Other Names: NULL

Uniprot

Q9FMM3

Link out to other resources with this protein ID : TAIR | PeptideAtlas | ARAPORT | PhosPhAt

PTMs

Sequence

Length: 1714

Domains & Sites

BLAST

Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here

AT5G42950.1

Arabidopsis thaliana [ath]

GYF domain-containing protein

97 PTM sites : 8 PTM types

PLAZA: AT5G42950

Gene Family: HOM05D003992

Other Names: NULL

Uniprot

Q9FMM3

Link out to other resources with this protein ID : TAIR | PeptideAtlas | ARAPORT | PhosPhAt

PTMs

Sequence

Length: 1714

Domains & Sites

BLAST

Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)A downloadable tutorial can be found here

Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here